General Information

  • ID:  hor001433
  • Uniprot ID:  A0A3B3IAD5
  • Protein name:  Neuropeptide FF
  • Gene name:  npff
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  Brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  ESVLHQPQRF
  • Length:  10
  • Propeptide:  MDTAAAMTLLALIVALAGISQALHVQDSLGKNDILPGSSEENVADRLLRLEDETREHSLDNRLLPLVVKALLLGFQRETRESVLHQPQRFGRSSRGQVVSDDQIQARDWEAAPGQIWSMAVPQRFGKK
  • Signal peptide:  MDTAAAMTLLALIVALAGISQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in modulating medaka behaviors
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3B3IAD5-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001433_AF2.pdbhor001433_ESM.pdb

Physical Information

Mass: 140109 Formula: C55H85N17O16
Absent amino acids: ACDGIKMNTWY Common amino acids: Q
pI: 7.55 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -98 Boman Index: -2893
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 68
Instability Index: 6678 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19118555
  • Title:  Mass Spectrometric Map of Neuropeptide Expression and Analysis of the Gamma-Prepro-Tachykinin Gene Expression in the Medaka (Oryzias Latipes) Brain